Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
3 for 2
pathway

PDGFA (Human) Recombinant ProteinBioActive

  • Catalog # : P4567
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PDGFA (P04085) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 28.5
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is calculated by the dose-dependent proliferation of mouse 3T3 indicator cells and is typically 3-5 ng/mL.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4567
    Lane 1: non-reducing conditions
    Lane 2: reducing conditions
  • Storage Buffer:
  • Lyophilized from a sterile filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
  • Storage Instruction:
  • Store at -20°C or -80°C.
    After reconstitution with 0.1 mL of sterilized water, store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 5154
  • Gene Name:
  • PDGFA
  • Gene Alias:
  • PDGF-A,PDGF1
  • Gene Description:
  • platelet-derived growth factor alpha polypeptide
  • Gene Summary:
  • The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer or as a heterodimer with the platelet-derived growth factor beta polypeptide, where the dimers are connected by disulfide bonds. Studies using knockout mice have shown cellular defects in oligodendrocytes, alveolar smooth muscle cells, and Leydig cells in the testis; knockout mice die either as embryos or shortly after birth. Two splice variants have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • PDGF A-chain,platelet-derived growth factor alpha,platelet-derived growth factor alpha chain,platelet-derived growth factor alpha isoform 2 preproprotein
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook