Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MSTN (Human) Recombinant ProteinBioActive

  • Catalog # : P4562
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MSTN recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLE
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 26.8
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the ability to inhibit 50 ng/mL of Myostatin activity on MPC-11 cells. The expected ED50 for this effect is 0.13-0.2 ug/mL.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with 5 mM acetic acid, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis
  • MPC-11 cells were cultured with 50 ng/mL human GDF15 and serial dilutions of human Myostatin Propeptide from 0-1 ug/mL. Cell proliferation was measured after 66 hours and the linear portion of the curve was us used to calculate the ED50.


  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2660
  • Gene Name:
  • MSTN
  • Gene Alias:
  • GDF8
  • Gene Description:
  • myostatin
  • Gene Summary:
  • The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. This gene is thought to encode a secreted protein which negatively regulates skeletal muscle growth. [provided by RefSeq
  • Other Designations:
  • growth differentiation factor 8
  • RSS
  • YouTube
  • Linkedin
  • Facebook