Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Vegfa (Mouse) Recombinant Protein

  • Catalog # : P4532
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Vegfa (NP_033531) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKRPRR
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 28.2
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • >= 97% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Vegfa
  • Gene Alias:
  • Vegf,Vegf-a,Vegf120,Vegf164,Vegf188,Vpf
  • Gene Description:
  • vascular endothelial growth factor A
  • Other Designations:
  • OTTMUSP00000017463,OTTMUSP00000017464,OTTMUSP00000022243,vascular permeability factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook