Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Cxcl16 (Mouse) Recombinant Protein

  • Catalog # : P4500
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Cxcl16 (Q8BSU2, 88 amino acids) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 9.9
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • >= 97% by SDS-PAGE and HPLC
  • Storage Buffer:
  • Lyophilized from 20 mM sodium phosphate, 50 mM NaCl, pH 7.4
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized ddH2O, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Cxcl16
  • Gene Alias:
  • 0910001K24Rik,AV290116,BB024863,SR-PSOX,Zmynd15
  • Gene Description:
  • chemokine (C-X-C motif) ligand 16
  • Other Designations:
  • Cxc chemokine ligand 16,OTTMUSP00000006308,SR-PSOX/CXCL16,Scavenger Receptor,zinc finger, MYND-type containing 15
  • RSS
  • YouTube
  • Linkedin
  • Facebook