Product Browser

Last updated: 2017/10/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Fgf7 (Mouse) Recombinant ProteinBioActive

  • Catalog # : P4492
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Fgf7 (P36363, 164 amino acids) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MCNDMSPEQTATSVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGIPVKGKKTKKEQKTAHFLPMAIT
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 18.9
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • >= 95% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug
  • Activity:
  • The ED50 calculated by the dose-dependant stimulation of KGF-responsive BaF3 indicator cells (measured by 3H-thymidine uptake) is < 10 ng/mL corresponding to a specific activity of 100,000 units/mg.
  • Storage Buffer:
  • Lyophilized from 20 mM phosphate, 0.1M NaCl, pH 8.0
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized ddH2O, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Fgf7
  • Gene Alias:
  • Kgf
  • Gene Description:
  • fibroblast growth factor 7
  • Other Designations:
  • Keratinocyte growth factor,OTTMUSP00000016341,OTTMUSP00000016342
  • RSS
  • YouTube
  • Linkedin
  • Facebook