NTF3 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Lane 1: non-reducing conditions
Lane 2: reducing conditions
Result of activity analysis
Result of activity analysis
C6 cells were cultured with 0 to 10 ug/mL human NTF3. Cell proliferation was measured after 7 days and the linear portion of the curve was us used to calculate the ED50.
-
Specification
Product Description
Human NTF3 (P20783) recombinant protein expressed in Escherichia coli.
Sequence
MYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRKIGRT
Host
Escherichia coli
Theoretical MW (kDa)
27.2
Form
Lyophilized
Preparation Method
Escherichia coli expression system
Endotoxin Level
< 0.1 EU/ug
Activity
The activity is determined by the dose-dependent proliferation of C6 cells. The expected ED50 for this effect is 3.6-5.4 ug/mL.
Quality Control Testing
1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Lane 1: non-reducing conditions
Lane 2: reducing conditionsStorage Buffer
Lyophilized from 0.02% TFA
Storage Instruction
Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.Note
Result of activity analysis
-
Applications
Functional Study
SDS-PAGE
-
Gene Info — NTF3
Entrez GeneID
4908Protein Accession#
P20783Gene Name
NTF3
Gene Alias
HDNF, MGC129711, NGF-2, NGF2, NT3
Gene Description
neurotrophin 3
Omim ID
162660Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the neurotrophin family, that controls survival and differentiation of mammalian neurons. This protein is closely related to both nerve growth factor and brain-derived neurotrophic factor. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NTF3-deficient mice generated by gene targeting display severe movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com