Product Browser

Last updated: 2021/4/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

CCL8 (Human) Recombinant Protein BioActive

  • Catalog # : P4423
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL8 (P80075) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 8.9
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the ability of MCP-2 to chemoattract THP-1 cells and is detectable starting at 100 ng/mL.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4423
    Lane 1: non-reducing conditions
    Lane 2: reducing conditions
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis

  • Human THP-1 cells were allowed to migrate to human CCL8 at (0, 0.1, 1, 10, 100 and 1000 ng/mL). After 45 minutes, cells that migrated were counted using a luminescent substrate and displayed on the bar graph above.


  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 6355
  • Gene Name:
  • CCL8
  • Gene Alias:
  • HC14,MCP-2,MCP2,SCYA10,SCYA8
  • Gene Description:
  • chemokine (C-C motif) ligand 8
  • Gene Summary:
  • This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils. By recruiting leukocytes to sites of inflammation this cytokine may contribute to tumor-associated leukocyte infiltration and to the antiviral state against HIV infection. [provided by RefSeq
  • Other Designations:
  • monocyte chemoattractant protein 2,monocyte chemotactic protein 2,small inducible cytokine A8,small inducible cytokine subfamily A (Cys-Cys), member 8 (monocyte chemotactic protein 2)
  • RSS
  • YouTube
  • Linkedin
  • Facebook