Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL21 (Human) Recombinant ProteinBioActive

  • Catalog # : P4412
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL21 (Q9HBE4) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 15.5
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the dose-dependent inhibition of Mino cells. The expected ED50 for this effect is 0.23-0.34 ng/mL.
  • Storage Buffer:
  • Lyopohilized from 20 mM Na2PO4, pH 7.5
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis
  • Serial dilutions of human IL21 (starting at 50 ng/mL) were added to Mino cells. After 66 hours, cell proliferation was measured and the linear portion of the curve was us used to calculate the ED50.


  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • IL21
  • Gene Alias:
  • IL-21,Za11
  • Gene Description:
  • interleukin 21
  • Other Designations:
  • interleukin-21 isoform
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook