Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL20 (Human) Recombinant ProteinBioActive

  • Catalog # : P4411
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL20 (Q9NYY1) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 35.2
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The biological activity is determined by the ability to activate STAT following receptor ligand interaction.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4411
    Lane 1: non-reducing conditions
    Lane 2: reducing conditions
  • Storage Buffer:
  • Lyophilized from 10 mM sodium citrate, 100 mM NaCl, pH 3.0
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • IL20
  • Gene Alias:
  • IL-20,IL10D,MGC96907,ZCYTO10
  • Gene Description:
  • interleukin 20
  • Gene Summary:
  • The protein encoded by this gene is a cytokine structurally related to interleukin 10 (IL10). This cytokine has been shown to transduce its signal through signal transducer and activator of transcription 3 (STAT3) in keratinocytes. A specific receptor for this cytokine is found to be expressed in skin and upregulated dramatically in psoriatic skin, suggesting a role for this protein in epidermal function and psoriasis. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000034617,OTTHUMP00000034618,four alpha helix cytokine
  • RSS
  • YouTube
  • Linkedin
  • Facebook