IL17F (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Non-reducing conditions
Result of activity analysis
Result of activity analysis
Serial dilutions of human IL17F (starting at 400 ng/mL) were added to NIH/3T3 cells. After 48 hours, production of mouse IL6 was measured and the linear portion of the curve was us used to calculate the ED50.
-
Specification
Product Description
Human IL17F (Q96PD4) recombinant protein expressed in Escherichia coli.
Sequence
MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
Host
Escherichia coli
Theoretical MW (kDa)
30
Form
Lyophilized
Preparation Method
Escherichia coli expression system
Endotoxin Level
< 0.1 EU/ug
Activity
The activity is determined by the dose-dependent production of IL-6 by mouse NIH 3T3 fibroblasts. The expected ED50 for this effect is 28-42 ng/mL.
Quality Control Testing
1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Non-reducing conditions
Storage Buffer
Lyophilized from 10 mM sodium citrate, pH 3.0
Storage Instruction
Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.Note
Result of activity analysis
-
Applications
Functional Study
SDS-PAGE
-
Gene Info — IL17F
Entrez GeneID
112744Protein Accession#
Q96PD4Gene Name
IL17F
Gene Alias
IL-17F, ML-1, ML1
Gene Description
interleukin 17F
Omim ID
606496Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytokine that shares sequence similarity with IL17. This cytokine is expressed by activated T cells, and has been shown to stimulate the production of several other cytokines, including IL6, IL8, and CSF2/GM_CSF. This cytokine is also found to inhibit the angiogenesis of endothelial cells and induce endothelial cells to produce IL2, TGFB1/TGFB, and monocyte chemoattractant protein-1. [provided by RefSeq
Other Designations
cytokine ML-1
-
Interactome
-
Disease
- Arthritis
- Asthma
- Behcet Syndrome
- Cardiovascular Diseases
- Colitis
- Crohn Disease
- Dermatitis
- Diabetes Mellitus
- Dyspepsia
+ View More Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com