Product Browser

Last updated: 2017/8/20

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Vote for Cancer Research Topics & Genes to Win One Free Antibody
pathway

IL11 (Human) Recombinant ProteinBioActive

  • Catalog # : P4405
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL11 (P20809) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 19.3
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the dose-dependent proliferation of T11 cells. The expected ED50 for this effect is 0.35-0.52 ng/mL.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4405
    Lane 1: non-reducing conditions
    Lane 2: reducing conditions
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis

  • Serial dilutions of human IL11 (starting at 100 ng/mL) were added to T-11 cells growing the presence of 2 ng/mL IL-6. After 91 hours, cell proliferation was measured and the linear portion of the curve was us used to calculate the ED50.


  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3589
  • Gene Name:
  • IL11
  • Gene Alias:
  • AGIF,IL-11
  • Gene Description:
  • interleukin 11
  • Gene Summary:
  • The protein encoded by this gene is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane signaling receptor IL6ST (gp130). This cytokine is shown to stimulate the T-cell-dependent development of immunoglobulin-producing B cells. It is also found to support the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells. [provided by RefSeq
  • Other Designations:
  • adipogenesis inhibitory factor,oprelvekin
  • RSS
  • YouTube
  • Linkedin
  • Facebook