Product Browser

Last updated: 2021/4/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

IL1A (Human) Recombinant Protein BioActive

  • Catalog # : P4402
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL1A (P01583) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 18
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the dose-dependent proliferation of mouse D10S cells. The expected ED50 for this effect is 0.6-0.8 pg/mL.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4402
    Non-reducing conditions
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis

  • Serial dilutions of human IL1A (starting at 250 pg/mL) were added to D10S cells. After 42 hours, cell proliferation was measured and the linear portion of the curve was us used to calculate the ED50.


  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3552
  • Gene Name:
  • IL1A
  • Gene Alias:
  • IL-1A,IL1,IL1-ALPHA,IL1F1
  • Gene Description:
  • interleukin 1, alpha
  • Gene Summary:
  • The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease. [provided by RefSeq
  • Other Designations:
  • IL1A (IL1F1),hematopoietin-1,preinterleukin 1 alpha,pro-interleukin-1-alpha
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook