Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IGF2 (Human) Recombinant ProteinBioActive

  • Catalog # : P4401
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IGF2 (P01344) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 7.5
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the dose dependent proliferation of FDC-P1 cells and is typically 1.5-6 ng/mL.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4401
    Lane 1: non-reducing conditions
    Lane 2: reducing conditions
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis
  • FDC-P1 cells were cultured with 0 to 250 ng/mL human IGF2. Cell proliferation was measured after 48 hours and the linear portion of the curve was us used to calculate the ED50.


  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3481
  • Gene Name:
  • IGF2
  • Gene Alias:
  • C11orf43,FLJ22066,FLJ44734,INSIGF,pp9974
  • Gene Description:
  • insulin-like growth factor 2 (somatomedin A)
  • Gene Summary:
  • This gene encodes a member of the insulin family of polypeptide growth factors that is involved in development and growth. It is an imprinted gene and is expressed only from the paternally inherited allele. It is a candidate gene for eating disorders. There is a read-through, INS-IGF2, which aligns to this gene at the 3' region and to the upstream INS gene at the 5' region. Alternatively spliced transcript variants, encoding either the same or different isoform, have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000011012,OTTHUMP00000011015,OTTHUMP00000011018,OTTHUMP00000011157,insulin-like growth factor 2,insulin-like growth factor II,insulin-like growth factor type 2,putative insulin-like growth factor II associated protein,somatomedin A
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook