Product Browser

Last updated: 2017/8/20

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Vote for Cancer Research Topics & Genes to Win One Free Antibody
pathway

IGF1 (Human) Recombinant ProteinBioActive

  • Catalog # : P4399
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IGF1 (P05019) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 7.7
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the dose-dependent proliferation of FDC-P1 cells. The expected ED50 for this effect is 0.65-0.98 ng/mL.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4399
    Lane 1: non-reducing conditions
    Lane 2: reducing conditions
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis

  • FDC-P1 cells were cultured with 0 to 250 ng/mL human IGF1. Cell proliferation was measured after 48 hours and the linear portion of the curve was us used to calculate the ED50.


  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3479
  • Gene Name:
  • IGF1
  • Gene Alias:
  • IGFI
  • Gene Description:
  • insulin-like growth factor 1 (somatomedin C)
  • Gene Summary:
  • The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Several transcript variants encoding different isoforms have been found for this gene
  • Other Designations:
  • insulin-like growth factor 1,somatomedin C
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook