Product Browser

Last updated: 2017/8/13

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Vote for Cancer Research Topics & Genes to Win One Free Antibody
pathway

CXCL2 (Human) Recombinant ProteinBioActive

  • Catalog # : P4396
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CXCL2 (P19875) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 7.9
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the ability to chemoattract purified human neutrophils and is detectable starting at 10 ng/mL.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis

  • Triplicate samples of primary human neutrophils from three donors were allowed to migrate to human CXCL2 (10, 100 and 1000 ng/mL). After 30 minutes, cells that migrated were counted using a luminescent substrate and displayed on the bar graph above.


  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2920
  • Gene Name:
  • CXCL2
  • Gene Alias:
  • CINC-2a,GRO2,GROb,MGSA-b,MIP-2a,MIP2,MIP2A,SCYB2
  • Gene Description:
  • chemokine (C-X-C motif) ligand 2
  • Other Designations:
  • GRO2 oncogene,MGSA beta,melanoma growth stimulatory activity beta
  • RSS
  • YouTube
  • Linkedin
  • Facebook