Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GDF5 (Human) Recombinant ProteinBioActive

  • Catalog # : P4393
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GDF5 (P43026) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • APSATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 26.8
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the ability to induce alkaline phosphatase activity in ATDC5 cells. The expected ED50 for this effect is 8-12 ng/mL.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis
  • Serial dilutions of human GDF5, starting at 5 ug/mL, were added to ATDC-5 cells growing in the presence of 4 ug/mL heparin. Alkaline phosphate activity was measure after 67 hours and the linear portion of the curve was us used to calculate the ED50.


  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 8200
  • Gene Name:
  • GDF5
  • Gene Alias:
  • BMP14,CDMP1,LAP4,SYNS2
  • Gene Description:
  • growth differentiation factor 5
  • Gene Summary:
  • The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Mutations in this gene are associated with acromesomelic dysplasia, Hunter-Thompson type; brachydactyly, type C; and chondrodysplasia, Grebe type. These associations confirm that the gene product plays a role in skeletal development. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000030755,OTTHUMP00000061644,cartilage-derived morphogenetic protein-1
  • RSS
  • YouTube
  • Linkedin
  • Facebook