Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LGALS3 (Human) Recombinant ProteinBioActive

  • Catalog # : P4391
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LGALS3 (Q61BA7) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISK
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 26
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the ability to induce chemotaxis of human PBMCs and is detectable starting at 1 ug/mL.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4391
    Lane 1: reducing conditions
    Lane 2: non-reducing conditions
  • Storage Buffer:
  • Lyophilized from 10 mM Na2PO4, 50 mM NaCl, pH 7.5
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis
  • Human PBMCs were allowed to migrate to human LGALS3 at (0, 0.01, 0.1, 1, 10 and 100 ug/mL). After 1 hour, cells that migrated were counted using a luminescent substrate and displayed on the bar graph above.


  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3958
  • Gene Name:
  • LGALS3
  • Gene Alias:
  • CBP35,GAL3,GALBP,GALIG,LGALS2,MAC2
  • Gene Description:
  • lectin, galactoside-binding, soluble, 3
  • Other Designations:
  • IgE-binding protein,MAC-2 antigen,carbohydrate-binding protein 35,galactose-specific lectin 3,galectin 3,galectin-3 internal,laminin-binding protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook