Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ADIPOQ (Human) Recombinant ProteinBioActive

  • Catalog # : P4389
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ADIPOQ (Q15848) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 16.7
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the ability to inhibit the proliferation of mouse M1 cells. The expected ED50 for this effect is 0.36-0.54 ug/mL.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4389
    Lane 1: non-reducing conditions
    Lane 2: reducing conditions
  • Storage Buffer:
  • Lyophilized from 10 mM Tris, pH 8.0 (0.75 mM DTT)
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized 5 mM Tris and 0.75 mM DTT to pH 8.0, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis
  • Serial dilutions of human ADIPOQ, starting at 25 ug/mL, were added to M1 cells. After 66 hours, cell viability was measured and the linear portion of the curve was us used to calculate the ED50.


  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 9370
  • Gene Name:
  • ADIPOQ
  • Gene Alias:
  • ACDC,ACRP30,ADPN,APM-1,APM1,GBP28,adiponectin
  • Gene Description:
  • adiponectin, C1Q and collagen domain containing
  • Gene Summary:
  • This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. [provided by RefSeq
  • Other Designations:
  • adipocyte, C1Q and collagen domain containing,adipocyte, C1Q and collagen domain-containing,adiponectin,adipose most abundant gene transcript 1,gelatin-binding protein 28
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook