Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FGF4 (Human) Recombinant ProteinBioActive

  • Catalog # : P4384
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FGF4 (P08620) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 19
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the ability to induce the proliferation of mouse NR6R-3T3 fibroblasts. The expected ED50 for this effect is less than 0.1 ng/mL.
  • Storage Buffer:
  • Lyophilized from 0.5X PBS, pH 7.5
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis
  • 3T3 cells were cultured with 0 to 1 ug/mL human FGF4. Cell proliferation was measured after 42 hours and the linear portion of the curve was us used to calculate the ED50.


  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2249
  • Gene Name:
  • FGF4
  • Gene Alias:
  • HBGF-4,HST,HST-1,HSTF1,K-FGF,KFGF
  • Gene Description:
  • fibroblast growth factor 4
  • Gene Summary:
  • The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified by its oncogenic transforming activity. This gene and FGF3, another oncogenic growth factor, are located closely on chromosome 11. Co-amplification of both genes was found in various kinds of human tumors. Studies on the mouse homolog suggested a function in bone morphogenesis and limb development through the sonic hedgehog (SHH) signaling pathway. [provided by RefSeq
  • Other Designations:
  • heparin secretory transforming protein 1,human stomach cancer, transforming factor from FGF-related oncogene,kaposi sarcoma oncogene,oncogene HST,transforming protein KS3
  • RSS
  • YouTube
  • Linkedin
  • Facebook