Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PROK1 (Human) Recombinant ProteinBioActive

  • Catalog # : P4380
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PROK1 (P58294) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • AVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 9.6
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the dose-dependent proliferation of MIA PaCa-2 cells and is typically 1-4 ug/mL.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4380
    Reducing conditions
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • PROK1
  • Gene Alias:
  • EGVEGF,PK1,PRK1
  • Gene Description:
  • prokineticin 1
  • Gene Summary:
  • Endocrine gland-derived vascular endothelial growth factor (EG-VEGF) induces proliferation, migration, and fenestration in capillary endothelial cells derived from endocrine glands. Its expression is induced by hypoxia and is restricted to the steroidogenic glands (ovary, testis, adrenal, and placenta). Its expression is often complementary to the expression of VEGF (MIM 192240), suggesting that these molecules function in a coordinated manner.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000013289,black mamba toxin-related protein,mambakine
  • RSS
  • YouTube
  • Linkedin
  • Facebook