Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RARRES2 (Human) Recombinant ProteinBioActive

  • Catalog # : P4378
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RARRES2 (Q99969) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAAVDTPFPAGIFVRLEFKLQQTSRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 16
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by its ability to chemoattract human Chem23R transfected BaF3 mouse pro-B cells and is typically 4-20 ng/mL.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4378
    Lane 1: non-reducing conditions
    Lane 2: reducing conditions
  • Storage Buffer:
  • Lyophilized from 0.2% TFA
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 5919
  • Gene Name:
  • RARRES2
  • Gene Alias:
  • CHEMERIN,HP10433,TIG2
  • Gene Description:
  • retinoic acid receptor responder (tazarotene induced) 2
  • Gene Summary:
  • This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine, and is truncated on both termini from the proprotein. [provided by RefSeq
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook