Product Browser

Last updated: 2020/5/31

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

ARTN (Human) Recombinant Protein BioActive

  • Catalog # : P4372
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ARTN (Q5T4W7) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • AGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 24.2
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the dose-dependant proliferation of the SH-SY5Y cell line and is typically 4-8 ng/mL. The activity can also determined by its ability to promote survival and neurite outgrowth.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4372
    Lane 1: non-reducing conditions
    Lane 2: reducing conditions
  • Storage Buffer:
  • Lyophilized from 10 mM sodium citrate, 25 mM NaCl, pH 4.5
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 9048
  • Gene Name:
  • ARTN
  • Gene Alias:
  • ENOVIN,EVN,NBN
  • Gene Description:
  • artemin
  • Gene Summary:
  • The protein encoded by this gene is a member of the glial cell line-derived neurotophic factor (GDNF) family of ligands which are a group of ligands within the TGF-beta superfamily of signaling molecules. GDNFs are unique in having neurotrophic properties and have potential use for gene therapy in neurodegenerative disease. Artemin has been shown in culture to support the survival of a number of peripheral neuron populations and at least one population of dopaminergic CNS neurons. Its role in the PNS and CNS is further substantiated by its expression pattern in the proximity of these neurons. This protein is a ligand for the RET receptor and uses GFR-alpha 3 as a coreceptor. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000009173,OTTHUMP00000009174,neublastin,neurotrophic factor,neurotrophic factor artemin
  • RSS
  • YouTube
  • Linkedin
  • Facebook