Cxcl12 (Mouse) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse Cxcl12 (P40224, 22 a.a. - 93 a.a.) partial recombinant protein expressed in Escherichia coli.
Sequence
KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRLKM
Host
Escherichia coli
Theoretical MW (kDa)
8
Form
Lyophilized
Preparation Method
Escherichia coli expression system
Purification
Ion exchange column and HPLC reverse phase column
Purity
> 90% by SDS-PAGE and HPLC
Endotoxin Level
Endotoxin content was assayed using a LAL gel clot method. Endotoxin level was found to be less than 0.1 ng/ug (1EU/ug).
Activity
Determined by the ability to chemoattract human peripheral T cells activated with PHA and IL-2 using a concentration range of 5-40 ng/mL.
Storage Buffer
Lyophilized from 2.5% glycine, 0.5% sucrose, 0.01% Tween 80, 5 mM Glutamic acid, pH 4.5
Storage Instruction
Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
Aliquot to avoid repeated freezing and thawing. -
Applications
Functional Study
SDS-PAGE
-
Gene Info — Cxcl12
Entrez GeneID
20315Protein Accession#
P40224Gene Name
Cxcl12
Gene Alias
AI174028, PBSF, PBSF/SDF-1, SDF-1, Scyb12, Sdf1, Sdf1a, Sdf1b, TLSF, TLSF-a, TLSF-b, TPAR1
Gene Description
chemokine (C-X-C motif) ligand 12
Gene Ontology
HyperlinkOther Designations
OTTMUSP00000026112|OTTMUSP00000026113|OTTMUSP00000026114|pre-B-cell growth-stimulating factor|stromal cell derived factor 1
-
Publication Reference
-
CXCL12-mediated monocyte transmigration into brain perivascular space leads to neuroinflammation and memory deficit in neuropathic pain.
Chun-Lin Mai, Zhi Tan, Ya-Nan Xu, Jing-Jun Zhang, Zhen-Hua Huang, Dong Wang, Hui Zhang, Wen-Shan Gui, Jun Zhang, Zhen-Jia Lin, Ying-Tong Meng, Xiao Wei, Ying-Tao Jie, Peter M Grace, Long-Jun Wu, Li-Jun Zhou, Xian-Guo Liu.
Theranostics 2021 Jan; 11(3):1059.
Application:Func, Mouse, Mouse plasma, Mouse tail vein.
-
CXCL12-mediated monocyte transmigration into brain perivascular space leads to neuroinflammation and memory deficit in neuropathic pain.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com