Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Kitl (Mouse) Recombinant ProteinBioActive

  • Catalog # : P4368
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Kitl (P20826, 36 a.a. - 189 a.a.) partial recombinant protein expressed in Insect cells.
  • Sequence:
  • KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
  • Host:
  • Insect
  • Theoretical MW (kDa):
  • 18
  • Form:
  • Lyophilized
  • Preparation Method:
  • Insect cell expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • Endotoxin content was assayed using a LAL gel clot method. Endotoxin level was found to be less than 0.1 ng/ug (1EU/ug).
  • Activity:
  • The ED50 was determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is < 2.0 ng/mL, corresponding to a specific activity of ≥ 5 x 105 units/mg.
  • Storage Buffer:
  • Lyophilized from 20 mM Tris, pH 7.5 (5% trehalose)
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Kitl
  • Gene Alias:
  • Clo,Con,Gb,Kitlg,Mgf,SCF,SF,SLF,Sl,Steel,contrasted
  • Gene Description:
  • kit ligand
  • Other Designations:
  • OTTMUSP00000022753,Steel factor,cloud gray,grizzle-belly,mast cell growth factor,stem cell factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook