S100a8 (Mouse) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse S100a8 (NP_038678, 1 a.a. - 89 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Sequence
MGSSHHHHHHSSGLVPRGSHMPSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE
Host
Escherichia coli
Theoretical MW (kDa)
12.4
Form
Liquid
Preparation Method
Escherichia coli expression system
Purification
Conventional Chromatography
Concentration
1 mg/mL
Purity
> 95% by SDS-PAGE
Quality Control Testing
15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer
In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (30% glycerol, 1 mM DTT).
Storage Instruction
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
Aliquot to avoid repeated freezing and thawing. -
Applications
SDS-PAGE
-
Gene Info — S100a8
-
Publication Reference
-
Rps14 haploinsufficiency causes a block in erythroid differentiation mediated by S100A8 and S100A9.
Schneider RK, Schenone M, Ferreira MV, Kramann R, Joyce CE, Hartigan C, Beier F, Brümmendorf TH, Germing U, Platzbecker U, Büsche G, Knüchel R, Chen MC, Waters CS, Chen E, Chu LP, Novina CD, Lindsley RC, Carr SA, Ebert BL.
Nature Medicine 2016 Mar; 22(3):288.
Application：WB, Recombinant Protein.
-
Inflammation-induced S100A8 activates Id3 and promotes colorectal tumorigenesis.
Zhang X, Ai F, Li X, She X, Li N, Tang A, Qin Z, Ye Q, Tian L, Li G, Shen S, Ma J.
International Journal of Cancer 2015 Dec; 137(12):2803.
Application：Func, Mouse, RAW 264.7 cells.
-
Rps14 haploinsufficiency causes a block in erythroid differentiation mediated by S100A8 and S100A9.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com