Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Gstm1 (Mouse) Recombinant ProteinBioActive

  • Catalog # : P4338
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Gstm1 (NP_034488, 1 a.a. - 218 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 28.1
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Activity:
  • Specific activity is < 11 units/mg, and is defined as the amount of enzyme that conjugate 1.0 umole of 1-chloro-2,4-dinitrobenzene (CDNB) with reduced glutathione per minute at pH 6.5 at 25°C.
  • Quality Control Testing:
  • 15% SDS-PAGE Stained with Coomassie Blue

    QC Testing of P4338
  • Storage Buffer:
  • In 20 mM Tris-HCl, pH 8.0. (10% glycerol, 1 mM DTT)
  • Storage Instruction:
  • Store at -20°C. For long term storage store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Gstm1
  • Gene Alias:
  • Gstb-1,Gstb1
  • Gene Description:
  • glutathione S-transferase, mu 1
  • Other Designations:
  • OTTMUSP00000007628,glutathione S-transferase mu 1,glutathione-S-transferase, mu 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook