Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Il15 (Mouse) Recombinant ProteinBioActive

  • Catalog # : P4336
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Il15 (NP_032383, 49 a.a. - 162 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMNWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 17.6
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 0.5 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Endotoxin Level:
  • < 1.0 EU per 1 microgram of protein
  • Activity:
  • Measured in a cell proliferation assay using CTLL2 mouse cytotoxic T cells. The ED50 for this effect is < 1 ng/mL.
  • Quality Control Testing:
  • 15% SDS-PAGE Stained with Coomassie Blue

    QC Testing of P4336
  • Storage Buffer:
  • In PBS, pH 7.4. (10% glycerol)
  • Storage Instruction:
  • Store at -20°C. For long term storage store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Il15
  • Gene Alias:
  • AI503618
  • Gene Description:
  • interleukin 15
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook