Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UPK3A (Human) Recombinant Protein

  • Catalog # : P4324
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human UPK3A (BAA31460, 19 a.a. - 207 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMGSHMVNLQPQLASVTFATNNPTLTTVALEKPLCMFDSKEALTGTHEVYLYVLVDSAISRNASVQDSTNTPLGSTFLQTEGGRTGPYKAVAFDLIPCSDLPSLDAIGDVSKASQILNAYLVRVGANGTCLWDPNFQGLCNPPLSAATEYRFKYVLVNMSTGLVEDQTLWSDPIRTNQLTPYSTIDTWPGRRSGG
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 23.1
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Concentration:
  • 0.25 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Quality Control Testing:
  • 15% SDS-PAGE Stained with Coomassie Blue

    QC Testing of P4324
  • Storage Buffer:
  • In 20 mM Tris-HCl, 150 mM NaCl, pH 8.0. (20% glycerol, 2 mM DTT)
  • Storage Instruction:
  • Store at -20°C. For long term storage store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7380
  • Gene Name:
  • UPK3A
  • Gene Alias:
  • MGC119178,UPIII,UPIIIA,UPK3
  • Gene Description:
  • uroplakin 3A
  • Gene Summary:
  • Uroplakins (UPK) are integral membrane proteins that form 2-dimensional crystalline arrays termed urothelial plaques that cover more than 90% of the apical urothelial surface. The asymmetric unit membrane (AUM) forms the apical plaques of urothelium and is believed to strengthen the urothelial apical surface and prevent the cells from rupturing during bladder distention. The 4 major conserved integral membrane proteins of the AUM are UPK1A (MIM 611557), UPK1B (MIM 602380), UPK2 (MIM 611558), and UPK3A.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000028951,uroplakin III
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook