Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CST9 (Human) Recombinant Protein

  • Catalog # : P4321
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CST9 (NP_001008693, 29 a.a. - 159 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMWCSEEEMGGNNKIVQDPMFLATVEFALNTFNVQSKEEHAYRLLRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 17.2
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Quality Control Testing:
  • 15% SDS-PAGE Stained with Coomassie Blue

    QC Testing of P4321
  • Storage Buffer:
  • In 20 mM Tris-HCl. pH 8.0. (10% glycerol, 0.4 M urea)
  • Storage Instruction:
  • Store at -20°C. For long term storage store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • CST9
  • Gene Alias:
  • CLM
  • Gene Description:
  • cystatin 9 (testatin)
  • Gene Summary:
  • The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a secreted protein that may play a role in hematopoietic differentiation or inflammation. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000030437,cystatin 9,cystatin-like molecule
  • RSS
  • YouTube
  • Linkedin
  • Facebook