Product Browser

Last updated: 2017/9/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

C8G (Human) Recombinant Protein

  • Catalog # : P4320
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human C8G (AAI13625, 21 a.a. - 202 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMQKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARGARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 22.6
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Concentration:
  • 0.5 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Quality Control Testing:
  • 15% SDS-PAGE Stained with Coomassie Blue

    QC Testing of P4320
  • Storage Buffer:
  • In 20 mM Tris-HCl, 0.15 M NaCl, pH 8.0. (10% glycerol, 2 mM DTT)
  • Storage Instruction:
  • Store at -20°C. For long term storage store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 733
  • Gene Name:
  • C8G
  • Gene Alias:
  • C8C,MGC142186
  • Gene Description:
  • complement component 8, gamma polypeptide
  • Gene Summary:
  • C8G is one of the three polypeptides that constitute C8, a component of the complement system. C8 participates in the formation of Membrane Attack Complex (MAC). Patients with deficiency in C8 are vulnerable to certain bacteria infection. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022634
  • RSS
  • YouTube
  • Linkedin
  • Facebook