Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SIT1 (Human) Recombinant Protein

  • Catalog # : P4317
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SIT1 (NP_055265, 1 a.a. -196 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMHLSQWTRGRSRSHPGQGRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRARASFPDQAYANSQPAAS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 16.9
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Concentration:
  • 0.25 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Quality Control Testing:
  • 15% SDS-PAGE Stained with Coomassie Blue

    QC Testing of P4317
  • Storage Buffer:
  • In 20 mM Tris-HCl, pH 8.0. (20% glycerol)
  • Storage Instruction:
  • Store at -20°C. For long term storage store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • SIT1
  • Gene Alias:
  • MGC125908,MGC125909,MGC125910,RP11-331F9.5,SIT
  • Gene Description:
  • signaling threshold regulating transmembrane adaptor 1
  • Other Designations:
  • OTTHUMP00000021333,SHP2 interacting transmembrane adaptor,SHP2-interacting transmembrane adaptor protein,suppression inducing transmembrane adaptor 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook