Product Browser

Last updated: 2017/10/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CHD7 (Human) Recombinant Protein

  • Catalog # : P4184
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CHD7 (P39476, 64 amino acids) partial recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 9.44
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • >= 99% by SDS-PAGE
  • Endotoxin Level:
  • < 0.1 ng/ug
  • Quality Control Testing:
  • SDS-PAGE Stained with Coomassie Blue

    QC Testing of P4184
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • CHD7
  • Gene Alias:
  • FLJ20357,FLJ20361,IS3,KAL5,KIAA1416
  • Gene Description:
  • chromodomain helicase DNA binding protein 7
  • Gene Summary:
  • This gene encodes a protein that contains several helicase family domains. Mutations in this gene have been found in some patients with the CHARGE syndrome. [provided by RefSeq
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook