Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RBP4 (Human) Recombinant ProteinBioActive

  • Catalog # : P4169
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RBP4 (P02753, 184 amino acids) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 21
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • >= 95% by SDS-PAGE and HPLC
  • Activity:
  • Immune reactive in ELISA using monoclonal anti CD4 in gpl2O capture ELISA assays.
  • Storage Buffer:
  • In 1X PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 5950
  • Gene Name:
  • RBP4
  • Gene Alias:
  • -
  • Gene Description:
  • retinol binding protein 4, plasma
  • Gene Summary:
  • This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000020114,OTTHUMP00000020116,retinol-binding protein 4, interstitial,retinol-binding protein 4, plasma
  • RSS
  • YouTube
  • Linkedin
  • Facebook