Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TDGF1 (Human) Recombinant ProteinBioActive

  • Catalog # : P4054
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TDGF1 (P13385, 139 amino acids) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 25
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • >= 95% by SDS-PAGE
  • Activity:
  • In a functional ELISA, immobilized recombinant human Activin RIB/Fc chimera receptor (0.2 ug/mL) will bind TDGF1 with linear range of 0.8 to 100 ng/mL.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -80°C on dry atmosphere.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 6997
  • Gene Name:
  • TDGF1
  • Gene Alias:
  • CR,CRGF,CRIPTO,Cripto-1
  • Gene Description:
  • teratocarcinoma-derived growth factor 1
  • Other Designations:
  • -
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook