Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CNTF (Human) Recombinant ProteinBioActive

  • Catalog # : P4045
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CNTF (P26441, 200 amino acids) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • AFAEQTPLTLHRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 22.834
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • >= 99% by SDS-PAGE
  • Activity:
  • Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.
  • Storage Buffer:
  • Lyophilized from 0.025% NaHCO3
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized ddH2O or 0.4 % NaHCO3 adjusted to pH 8-9, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 1270
  • Gene Name:
  • CNTF
  • Gene Alias:
  • HCNTF
  • Gene Description:
  • ciliary neurotrophic factor
  • Gene Summary:
  • The protein encoded by this gene is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. A read-through transcript variant composed of ZFP91 and CNTF sequence has been identified, but it is thought to be non-coding. Read-through transcription of ZFP91 and CNTF has also been observed in mouse. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000174731
  • RSS
  • YouTube
  • Linkedin
  • Facebook