Apoa2 (Mouse) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse Apoa2 full-length ORF (NP_038502, 24 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
QADGPDMQSLFTQYFQSMTEYGKDLVEKAKTSEIQSQVKAYFEKTHEQLTPLVRSAGTSLVNFFSSLMNLEEKPAPAAK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
34.32
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — Apoa2
Entrez GeneID
11807GeneBank Accession#
NM_013474.2Protein Accession#
NP_038502Gene Name
Apoa2
Gene Alias
Alp-2, ApoA-II, ApoAII, Apoa-2, Hdl-1
Gene Description
apolipoprotein A-II
Gene Ontology
HyperlinkOther Designations
OTTMUSP00000024197|OTTMUSP00000024198|OTTMUSP00000024207|OTTMUSP00000024208
-
Publication Reference
-
Dysfunctional high-density lipoproteins have distinct composition, diminished anti-inflammatory potential and discriminate acute coronary syndrome from stable coronary artery disease patients.
Mihaela G Carnuta, Camelia S Stancu, Laura Toma, Gabriela M Sanda, Loredan S Niculescu, Mariana Deleanu, Andreea C Popescu, Mihaela R Popescu, Adelina Vlad, Doina R Dimulescu, Maya Simionescu, Anca V Sima.
Scientific Reports 2017 Aug; 7(1):7295.
Application：Quant, Human, Serum.
-
Dysfunctional high-density lipoproteins have distinct composition, diminished anti-inflammatory potential and discriminate acute coronary syndrome from stable coronary artery disease patients.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com