Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Apoa2 (Mouse) Recombinant Protein

  • Catalog # : P4028
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Apoa2 full-length ORF (NP_038502, 24 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • QADGPDMQSLFTQYFQSMTEYGKDLVEKAKTSEIQSQVKAYFEKTHEQLTPLVRSAGTSLVNFFSSLMNLEEKPAPAAK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.32
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue

    QC Testing of P4028
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • Apoa2
  • Gene Alias:
  • Alp-2,ApoA-II,ApoAII,Apoa-2,Hdl-1
  • Gene Description:
  • apolipoprotein A-II
  • Other Designations:
  • OTTMUSP00000024197,OTTMUSP00000024198,OTTMUSP00000024207,OTTMUSP00000024208
  • RSS
  • YouTube
  • Linkedin
  • Facebook