Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ABO (Human) Recombinant Protein

  • Catalog # : P3941
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ABO (NP_065202, 54 a.a. - 354 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMAVREPDHLQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 37.4
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 0.5 mg/mL
  • Purity:
  • > 85% by SDS-PAGE
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS PAGE.

    QC Testing of P3941
  • Storage Buffer:
  • In 20 mM Tris-HCl, 200 mM NaCl, pH 8.0 (2 mM dithiothreitol, 20% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 28
  • Gene Name:
  • ABO
  • Gene Alias:
  • A3GALNT,A3GALT1,GTB,NAGAT
  • Gene Description:
  • ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase)
  • Gene Summary:
  • This gene encodes proteins related to the first discovered blood group system, ABO. Which allele is present in an individual determines the blood group. The 'O' blood group is caused by a deletion of guanine-258 near the N-terminus of the protein which results in a frameshift and translation of an almost entirely different protein. Individuals with the A, B, and AB alleles express glycosyltransferase activities that convert the H antigen into the A or B antigen. Other minor alleles have been found for this gene. [provided by RefSeq
  • Other Designations:
  • ABO glycocyltransferase,ABO glycosyltransferase,B(A) alpha-1,3-galactosyltransferase,alpha 1-3-N-acetylgalactosaminyltransferase,histo-blood group A2 transferase,histo-blood group ABO protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook