Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KAT2A (Human) Recombinant Protein

  • Catalog # : P3938
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human KAT2A (NP_066564, 411 a.a. - 837 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMGGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 51.1
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 0.25 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS PAGE.

    QC Testing of P3938
  • Storage Buffer:
  • In 20 mM Tris-HCl, 200 mM NaCl, 1 mM EDTA, pH 8.0 (5 mM dithiothreitol, 40% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2648
  • Gene Name:
  • KAT2A
  • Gene Alias:
  • GCN5,GCN5L2,MGC102791,PCAF-b,hGCN5
  • Gene Description:
  • K(lysine) acetyltransferase 2A
  • Gene Summary:
  • KAT2A, or GCN5, is a histone acetyltransferase (HAT) that functions primarily as a transcriptional activator. It also functions as a repressor of NF-kappa-B (see MIM 164011) by promoting ubiquitination of the NF-kappa-B subunit RELA (MIM 164014) in a HAT-independent manner (Mao et al., 2009 [PubMed 19339690]).[supplied by OMIM
  • Other Designations:
  • GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 2,GCN5 general control of amino-acid synthesis 5-like 2,General control of amino acid synthesis, yeast, homolog-like 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook