Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NT5M (Human) Recombinant Protein

  • Catalog # : P3933
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NT5M (NP_064586, 32 a.a. - 228 a.a. ) partial recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRPC
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 25.1
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 0.5 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Storage Buffer:
  • In 20 mM Tris-HCl, 100 mM pH 8.0 (20% glycerol, 1 mM dithiothreitol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • NT5M
  • Gene Alias:
  • dNT-2,dNT2,mdN
  • Gene Description:
  • 5',3'-nucleotidase, mitochondrial
  • Gene Summary:
  • This gene encodes a 5' nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5'- and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq
  • Other Designations:
  • 5' nucleotidase, mitochondrial,5(3)-deoxyribonucleotidase,deoxy-5'-nucleotidase 2,mitochondrial 5' nucleotidase
  • RSS
  • YouTube
  • Linkedin
  • Facebook