Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MRCL3 (Human) Recombinant Protein

  • Catalog # : P3932
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MRCL3 (NP_006462, 1 a.a. - 171 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMGSHMSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 22.4
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 0.25 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Storage Buffer:
  • In 20 mM Tris-HCl, pH 8.0 (20% glycerol, 1 mM dithiothreitol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • MRCL3
  • Gene Alias:
  • MLCB,MRLC3
  • Gene Description:
  • myosin regulatory light chain MRCL3
  • Other Designations:
  • myosin regulatory light chain MRLC3,myosin, light polypeptide, regulatory, non-sarcomeric (20kD)
  • RSS
  • YouTube
  • Linkedin
  • Facebook