Product Browser

Last updated: 2017/12/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

F3 (Human) Recombinant Protein

  • Catalog # : P3830
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human F3 (NP_001984.1, 33 a.a. - 251 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE
  • Host:
  • Escherichia coli
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 95% by SDS-PAGE
  • Quality Control Testing:
  • 10% SDS-PAGE Result

    QC Testing of P3830
  • Storage Buffer:
  • In saline or Tris (50% glycerol)
  • Storage Instruction:
  • Store at -20°C. For long term storage store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Immunohistochemistry
  • ELISA
  • Dot Blot
  • SDS-PAGE
  • Application Image
  • Western Blot
  • Immunohistochemistry
  • ELISA
  • Dot Blot
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2152
  • Gene Name:
  • F3
  • Gene Alias:
  • CD142,TF,TFA
  • Gene Description:
  • coagulation factor III (thromboplastin, tissue factor)
  • Gene Summary:
  • This gene encodes coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces. There are 3 distinct domains of this factor: extracellular, transmembrane, and cytoplasmic. This protein is the only one in the coagulation pathway for which a congenital deficiency has not been described. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000012426,coagulation factor III,tissue factor
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook