Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL12A (Human) Recombinant Protein

  • Catalog # : P3812
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL12A (NP_000873.2, 57 a.a. - 253 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
  • Host:
  • Escherichia coli
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 95% by SDS-PAGE
  • Quality Control Testing:
  • 10% SDS-PAGE Result

    QC Testing of P3812
  • Storage Buffer:
  • In PBS (50% glycerol)
  • Storage Instruction:
  • Store at -20°C. For long term storage store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3592
  • Gene Name:
  • IL12A
  • Gene Alias:
  • CLMF,IL-12A,NFSK,NKSF1,P35
  • Gene Description:
  • interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35)
  • Gene Summary:
  • This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-independent induction of interferon (IFN)-gamma, and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity. [provided by RefSeq
  • Other Designations:
  • IL-12, subunit p35,NF cell stimulatory factor chain 1,cytotoxic lymphocyte maturation factor 1, p35,interleukin 12, p35,interleukin 12A,interleukin-12 alpha chain,natural killer cell stimulatory factor 1, 35 kD subunit
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook