Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PMP2 (Human) Recombinant Protein

  • Catalog # : P3802
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PMP2 (NP_002668.1, 1 a.a. - 132 a.a.) full-length recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
  • Host:
  • Escherichia coli
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 95% by SDS-PAGE
  • Quality Control Testing:
  • 10% SDS-PAGE Result

    QC Testing of P3802
  • Storage Buffer:
  • In PBS (50% glycerol)
  • Storage Instruction:
  • Store at -20°C. For long term storage store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 5375
  • Gene Name:
  • PMP2
  • Gene Alias:
  • FABP8,M-FABP,MP2,P2
  • Gene Description:
  • peripheral myelin protein 2
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook