Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

VTA1 (Human) Recombinant Protein

  • Catalog # : P3796
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human VTA1 (Q9NP79) full-length recombinant protein in yeast.
  • Sequence:
  • MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENEDAGAASLPTQPTQPSSSSTYDPSNMPSGNYTGIQIPPGAHAPANTPAEVPHSTGVASNTIQPTPQTIPAIDPALFNTISQGDVRLTPEDFARAQKYCKYAGSALQYEDVSTAVQNLQKALKLLTTGRE
  • Host:
  • Yeast
  • Theoretical MW (kDa):
  • 34
  • Form:
  • Liquid
  • Preparation Method:
  • Yeast expression system
  • Purification:
  • Affinity Purification
  • Purity:
  • 90%
  • Storage Buffer:
  • In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol)
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • VTA1
  • Gene Alias:
  • C6orf55,DRG-1,DRG1,FLJ27228,HSPC228,LIP5,My012,SBP1
  • Gene Description:
  • Vps20-associated 1 homolog (S. cerevisiae)
  • Gene Summary:
  • C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes (Ward et al., 2005 [PubMed 15644320]).[supplied by OMIM
  • Other Designations:
  • LYST-interacting protein 5,OTTHUMP00000017318,Vps20-associated 1 homolog,homolog of mouse SKD1-binding protein 1
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook