Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KAAG1 (Human) Recombinant Protein

  • Catalog # : P3776
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human KAAG1 (NM_181337) full-length recombinant protein expressed in yeast.
  • Sequence:
  • MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK
  • Host:
  • Yeast
  • Theoretical MW (kDa):
  • 8.959
  • Form:
  • Liquid
  • Preparation Method:
  • Yeast expression system
  • Purification:
  • Affinity Purification
  • Purity:
  • 90%
  • Storage Buffer:
  • In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol)
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • KAAG1
  • Gene Alias:
  • MGC78738,RU2AS
  • Gene Description:
  • kidney associated antigen 1
  • Other Designations:
  • OTTHUMP00000016084
  • RSS
  • YouTube
  • Linkedin
  • Facebook