Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ANP32C (Human) Recombinant Protein

  • Catalog # : P3771
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ANP32C (O43423) full-length recombinant protein expressed in yeast.
  • Sequence:
  • MEMGRRIHSELRNRAPSDVKELALDNSRSNEGKLEALTDEFEELEFLSKINGGLTSISDLPKLKLRKLELRVSGGLEVLAEKCPNLTHLYLSGNKIKDLSTIEPLKQLENLKSLDLFNCEVTNLNDYGENVFKLLLQLTYLDSCYWDHKEAPYSDIEDHVEGLDDEEEGEHEEEYDEDAQVVEDEEGEEEEEEGEEEDVSGGDEEDEEGYNDGEVDGEEDEEELGEEERGQKRK
  • Host:
  • Yeast
  • Theoretical MW (kDa):
  • 26.733
  • Form:
  • Liquid
  • Preparation Method:
  • Yeast expression system
  • Purification:
  • Affinity Purification
  • Purity:
  • 90%
  • Storage Buffer:
  • In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol)
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • ANP32C
  • Gene Alias:
  • PP32R1
  • Gene Description:
  • acidic (leucine-rich) nuclear phosphoprotein 32 family, member C
  • Gene Summary:
  • Phosphoprotein 32 (PP32) is a tumor suppressor that can inhibit several types of cancers, including prostate and breast cancers. The protein encoded by this gene is one of at least two proteins that are similar in amino acid sequence to PP32 and are part of the same acidic nuclear phosphoprotein gene family. However, unlike PP32, the encoded protein is tumorigenic. The tumor suppressor function of PP32 has been localized to a 25 amino acid region that is divergent between PP32 and the protein encoded by this gene. This gene does not contain introns. [provided by RefSeq
  • Other Designations:
  • acidic nuclear phosphoprotein 32C,pp32 related 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook