Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DIABLO (Human) Recombinant Protein

  • Catalog # : P3733
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DIABLO (NP_063940.1) full-length recombinant protein expressed in yeast.
  • Sequence:
  • MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
  • Host:
  • Yeast
  • Theoretical MW (kDa):
  • 27.1
  • Form:
  • Liquid
  • Preparation Method:
  • Yeast expression system
  • Purification:
  • Affinity Purification
  • Purity:
  • 90%
  • Storage Buffer:
  • In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol)
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • DIABLO
  • Gene Alias:
  • DIABLO-S,FLJ10537,FLJ25049,SMAC,SMAC3
  • Gene Description:
  • diablo homolog (Drosophila)
  • Gene Summary:
  • This gene encodes an inhibitor of apoptosis protein (IAP)-binding protein. The encoded mitochondrial protein enters the cytosol when cells undergo apoptosis, and it moderates the caspase inhibition of IAPs. Multiple polyadenylation sites have been found for this gene. Four alternatively spliced transcript variants have been described for this gene, with two of them encoding different isoforms and the other two probably not encoding a protein. [provided by RefSeq
  • Other Designations:
  • 0610041G12Rik,diablo,direct IAP-binding protein with low pI,mitochondrial Smac protein,second mitochondria-derived activator of caspase
  • RSS
  • YouTube
  • Linkedin
  • Facebook