Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HDAC2 (Human) Recombinant Protein

  • Catalog # : P3732
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HDAC2 (NP_001518, 1 a.a. - 488 a.a.) full-length recombinant protein with His tag expressed in Hi-5 cells.
  • Sequence:
  • MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNPSRHHHHHH
  • Host:
  • Insect
  • Theoretical MW (kDa):
  • 56.4
  • Form:
  • Liquid
  • Preparation Method:
  • Insect cell (Hi-5) expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 0.25 mg/mL
  • Purity:
  • > 85% by SDS-PAGE
  • Storage Buffer:
  • In 20 mM Tris-HCl, 100 mM NaCl, 0.1 mM PMSF, pH 8.0 (20% glycerol, 1 mM dithiothreitol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3066
  • Gene Name:
  • HDAC2
  • Gene Alias:
  • RPD3,YAF1
  • Gene Description:
  • histone deacetylase 2
  • Gene Summary:
  • This gene product belongs to the histone deacetylase family. Histone deacetylases act via the formation of large multiprotein complexes and are responsible for the deacetylation of lysine residues on the N-terminal region of the core histones (H2A, H2B, H3 and H4). This protein also forms transcriptional repressor complexes by associating with many different proteins, including YY1, a mammalian zinc-finger transcription factor. Thus it plays an important role in transcriptional regulation, cell cycle progression and developmental events. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000040427,YY1-associated factor 1,transcriptional regulator homolog RPD3
  • RSS
  • YouTube
  • Linkedin
  • Facebook