Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SULT1A2 (Human) Recombinant Protein

  • Catalog # : P3722
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SULT1A2 (NP_001045, 1 a.a. - 295 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 36.4
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Storage Buffer:
  • In 20 mM Tris-HCl, 100 mM, pH 8.0 (1 mM dithiothreitol, 10% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 6799
  • Gene Name:
  • SULT1A2
  • Gene Alias:
  • HAST4,MGC142287,MGC142289,P-PST,ST1A2,STP2,TSPST2
  • Gene Description:
  • sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2
  • Gene Summary:
  • Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Two alternatively spliced variants that encode the same protein have been described. [provided by RefSeq
  • Other Designations:
  • aryl sulfotransferase,arylamine sulfotransferase,phenol-preferring phenol sulfotransferase2,phenol-sulfating phenol sulfotransferase 2,phenolic-metabolizing (P) form of PST,thermostable phenol sulfotransferase
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook