Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

THPO (Human) Recombinant ProteinBioActive

  • Catalog # : P3680
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human THPO (P40225, 1 a.a. - 353 a.a.) full-length recombinant protein. expressed in CHO cells.
  • Sequence:
  • MELTELLLVVMLLLTARLTLSSPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
  • Host:
  • Hamster
  • Theoretical MW (kDa):
  • 80
  • Form:
  • Lyophilized
  • Preparation Method:
  • Mammalian cell (CHO) expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • The ED50 was determined by the dose-dependent proliferation of Mo7e cells, was found to be in the range of 1.0-2.0 ng/mL.
  • Storage Buffer:
  • Lyophilized from PBS, pH 7
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7066
  • Gene Name:
  • THPO
  • Gene Alias:
  • MGC163194,MGDF,MKCSF,ML,MPLLG,TPO
  • Gene Description:
  • thrombopoietin
  • Gene Summary:
  • Megakaryocytopoiesis is the cellular development process that leads to platelet production. The protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. [provided by RefSeq
  • Other Designations:
  • MPL ligand,c-mpl ligand,megakaryocyte colony-stimulating factor,megakaryocyte growth and development factor,megakaryocyte stimulating factor,myeloproliferative leukemia virus oncogene ligand,thrombopoietin nirs variant 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook